Account Contact
Filter
Your Cart
Pay the courier with no extra fees.
Need help? DistriNode AI can handle any task on our site.

Oscillating Multi-Tools (82)

Tools, Construction & Workshop
Choose Oscillating Multi-Tools with confidence for real-world use

Explore Oscillating Multi-Tools at DistriNode with live availability, distributor-backed sourcing and practical options for home, office, IT, service and business environments. Compare key specifications, brand families and use cases before you buy.

82 products15 brandsEveryday → ProfessionalOfficial distributor

How to Choose

Compatibility & fit
Start with the device, system, size, interface or application the product must work with. Matching the exact requirement prevents returns and avoids hidden installation delays.
Specification level
Compare capacity, speed, material, power rating, format, standard or feature set rather than choosing by price alone. The right specification usually saves time over the product lifetime.
Environment & workload
Think about where the item will be used: desk, rack, workshop, warehouse, vehicle, classroom, kitchen, outdoor area or managed business fleet.
Warranty & supply
For repeat purchasing, prefer reliable brands, clear availability and distributor-backed warranty. This keeps replacements and multi-site rollouts predictable.

What You'll Find Here

Oscillating Multi-ToolsTools, Construction & WorkshopBusiness useHome useProfessional equipmentReplacement partsAccessoriesConsumablesInstallation suppliesCompatible options

Leading Brands

BOSCHFEINMAKITADEWALTEINHELLSTANLEYMETABOBLACK & DECKERBATAVIA B.V.RYOBINEXTOOLGRAPHITESKIL
Buying tip: Check the exact model, size, interface, voltage, capacity or standard before ordering. Small specification differences can decide whether a product fits perfectly or causes extra work.

Frequently Asked Questions

How do I choose the right product in this category?
Start with compatibility, then compare the specification that affects daily use: size, capacity, speed, interface, material, power rating, standard or supported device family.
Are these products suitable for business purchasing?
Yes. DistriNode is built for repeat purchasing with live availability, broad brand coverage and distributor-backed sourcing across the category.
What should I check before ordering?
Verify model fit, quantity, installation requirements and warranty expectations. For technical products, also check standards, connectors, voltage, dimensions or supported platforms.
Brand: MAKITA Stock: 5
Multi-function tool TM3010CX4J blue black MakPac size 2 320 watts 41-piece accessory set — Genuine MAKITA product supplied by DistriNode.Available wit..
Colour Black Power Source... AC Applications Cutting & Sanding & Sawing
R7,450
Ex Tax:R6,478
2 suppliers Reward +R28
Add to Cart
Brand: BOSCH Stock: 12
The Bosch GOP 12V-28 Professional multi-tool is a compact, battery-powered oscillating tool designed for a range of renovation and finishing tasks. It..
Power Source... Battery Adjustable S... Yes Oscillation ... 20000 OPM Applications Grinding & Sanding & Sawing & Scraping
R2,701
Ex Tax:R2,349
3 suppliers Reward +R8
Add to Cart
Brand: BOSCH Stock: 1
The Bosch PMF 220 CE is a compact sanding machine and multi-tool with a 220 W motor designed for cutting, grinding and sanding tasks. It features a va..
Colour Black Input Power 220 W Power Source... AC Applications Cutting & Grinding & Sawing
R1,759
Ex Tax:R1,529
3 suppliers Reward +R6
Add to Cart
Brand: FEIN Stock: 2
FEIN MultiMaster MM 300 Plus Start oscillating multi-tool in L-BOXX — Genuine FEIN product supplied by DistriNode.Available with live stock, verified ..
Power Source... AC Applications Cutting & Sanding & Sawing
R5,231
Ex Tax:R4,549
2 suppliers Reward +R16
Add to Cart
Brand: RYOBI Stock: 1
The Cordless multi-tool Sourcing RYOBI ONE+ RMT18-0 18 V — without battery is an 18 V oscillating tool designed for cutting, sanding, scraping and pre..
Colour Black Power Source... Battery Applications Cutting & Sanding & Sawing
R2,081
Ex Tax:R1,810
2 suppliers Reward +R6
Add to Cart
Brand: FEIN Stock: 2
Fein Tool MULTI. Multimaster MM700 Max — Genuine FEIN product supplied by DistriNode.Available with live stock, verified product data, official manufa..
Power Source... AC Applications Cutting & Sanding & Sawing
R7,114
Ex Tax:R6,186
3 suppliers Reward +R23
Add to Cart
Brand: BLACK & DECKER Stock: 2
Black & Decker MT300SA2, cutting, sanding, polishing, Rust/corrosion removing, Saws, scraping, Black, Orange, 10000 OPM, 101 dB, 90 dB, AC — Genuine B..
Colour Black Power Source... AC Applications Cutting & Sanding & Sawing
R1,799
Ex Tax:R1,564
1 supplier Reward +R6
Add to Cart
Brand: BOSCH Stock: 2
The Bosch 0603104001 sander is a handheld electric tool designed for surface finishing on wood, metal and other materials. It combines a powerful moto..
Colour Black Power Source... Battery Carrying Case Yes Applications Grinding & Sanding & Sawing
R4,969
Ex Tax:R4,321
1 supplier Reward +R18
Add to Cart
Brand: SKIL Stock: 19
SKIL 1475AA is a corded oscillating multi tool powered from a 230V mains supply with a 300W motor. It is designed for cutting, sanding, scraping and l..
Input Power 300 W Power Source... AC Applications Cutting & Sanding & Sawing
R1,874
Ex Tax:R1,629
1 supplier Reward +R4
Add to Cart
Brand: FEIN Stock: 4
The FEIN Multimaster MM 500 Plus Basic is a powerful and versatile multi-tool designed for professional tradespeople. With a 350 W high-performance mo..
Power Source... AC
R5,371
Ex Tax:R4,671
4 suppliers Reward +R18
Add to Cart
Brand: BOSCH Stock: 1
The Bosch PMF 350 CES is a compact multi-tool for cutting, grinding and sawing tasks that require precision and control. Equipped with a 350 W motor a..
Colour Black Input Power 350 W Power Source... AC Applications Cutting & Grinding & Sawing
R3,722
Ex Tax:R3,237
1 supplier Reward +R13
Add to Cart
Brand: BOSCH Stock: 1
The Bosch 0603104000 sander is a compact sanding machine intended for efficient surface finishing. It combines a robust motor, ergonomic housing and a..
Colour Black Power Source... Battery Carrying Case Yes Applications Grinding & Sanding & Sawing
R2,640
Ex Tax:R2,295
2 suppliers Reward +R9
Add to Cart
Brand: MAKITA Stock: 10
The Makita DTM53RTJX1 is a high-performance cordless multi-tool powered by an 18V LXT Lithium-Ion battery. Featuring a brushless motor and Starlock MA..
Power Source... Battery
R7,334
Ex Tax:R6,377
4 suppliers Reward +R27
Add to Cart
Brand: FEIN Stock: 8
Fein MM 500 Top Edition 350 W is an oscillating multifunction tool designed for precise cutting, sanding, scraping and grinding in renovation and repa..
Input Power 350 W Power Source... AC Applications Grinding & Sanding & Sawing & Scraping
R5,041
Ex Tax:R4,384
4 suppliers Reward +R18
Add to Cart
Brand: FEIN Stock: 10
The FEIN MultiMaster AMM 500 Plus Top AS is a cordless oscillating multi-tool powered by an 18 V Lithium‑Ion battery. With an idle speed adjustable be..
Power Source... Battery Carrying Case Yes Applications Cutting & Sanding & Sawing
R4,924
Ex Tax:R4,282
5 suppliers Reward +R15
Add to Cart
Brand: FEIN Stock: 2
The Fein AMM 500 Plus Battery 18V is a cordless multifunction oscillating tool designed for cutting, sanding, scraping and grout removal during renova..
Power Source... Battery Applications Cutting & Sanding & Sawing
R6,697
Ex Tax:R5,824
2 suppliers Reward +R25
Add to Cart
Brand: FEIN Stock: 6
The Fein MultiMaster MM 500 Selection is a high-performance oscillating multi-tool designed for professional tradespeople. With a powerful 350 W motor..
Power Source... AC
R5,884
Ex Tax:R5,116
2 suppliers Reward +R22
Add to Cart
Brand: SKIL Stock: 56
The SKIL Multi Tool 1491DB is a powerful and versatile corded oscillating tool designed for cutting, sanding, scraping, and grinding a wide range of m..
Power Source... AC
R2,148
Ex Tax:R1,868
1 supplier Reward +R5
Add to Cart
Brand: NO NAME Stock: 200
On a busy renovation site, a carpenter reaches for the TC8508K_18 to make a flush cut in a door frame without removing it. The 18V cordless multi tool..
Power Source... Battery
R1,162
Ex Tax:R1,010
1 supplier Reward +R2
Add to Cart
Brand: RYOBI Stock: 11
The RYOBI RMT200-S is a powerful 200W corded oscillating multi-tool designed for a wide range of cutting, sanding, scraping, and grinding applications..
Power Source... AC
R2,258
Ex Tax:R1,963
1 supplier Reward +R7
Add to Cart
Brand: RYOBI Stock: 5
The RYOBI RAK05MT is a cordless oscillating multi-tool engineered for high-performance cutting, sanding, and scraping across a vast range of materials..
Power Source... Battery
R1,444
Ex Tax:R1,256
1 supplier Reward +R4
Add to Cart
Brand: FEIN Stock: 6
For stubborn residue that laughs at ordinary blades, the FEIN Starlock Rigid Scraper Blade delivers uncompromising removal power. Its 52 mm wide, robu..
R958
Ex Tax:R833
1 supplier Reward +R3
Add to Cart
Brand: FEIN Stock: 3
Cutting, sanding, scraping, and grinding in tight spaces often demands multiple tools, slowing down renovation and installation work. The Fein MM 700 ..
Power Source... AC
R10,330
Ex Tax:R8,983
1 supplier Reward +R40
Add to Cart
Brand: GRAPHITE Stock: 100
The GRAPHITE MFP 500W Oscillating Multi-Tool is a powerful and versatile tool designed for cutting, sanding, scraping, and grinding a wide range of ma..
Quantity Per... 1 piece
R1,992
Ex Tax:R1,733
1 supplier Reward +R5
Add to Cart
Brand: RYOBI Stock: 20
The RYOBI 300W Multi-Tool RMT300-SA is a versatile corded electric oscillating tool designed for cutting, sanding, scraping, and grinding. With a powe..
Power Source... AC
R3,691
Ex Tax:R3,210
1 supplier Reward +R12
Add to Cart
Brand: RYOBI Stock: 35
The RYOBI multifunction grinder is a versatile oscillating multi-tool designed for a wide range of cutting, sanding, scraping, and grinding applicatio..
Power Source... AC
R2,657
Ex Tax:R2,311
1 supplier Reward +R8
Add to Cart
Brand: FESTOOL Stock: 1
Cutting, sawing, scraping, and sanding in tight spaces often means juggling multiple tools or struggling with cords. The Festool OSC 18 E-Basic solves..
Power Source... Battery
R4,130
Ex Tax:R3,591
1 supplier Reward +R15
Add to Cart
Brand: FEIN Stock: 21
The FEIN 92602102000 MultiMaster is a high-performance oscillating multi-tool engineered for demanding cutting, sanding, and scraping tasks. Its 350 W..
Power Source... AC
R1,513
Ex Tax:R1,316
1 supplier Reward +R5
Add to Cart
Brand: FEIN Stock: 4
Built for the punishing demands of bus and truck maintenance, the Fein MM 700 1.7Q stands apart from standard oscillating tools. Its high-power 250 W ..
Power Source... AC
R13,119
Ex Tax:R11,408
1 supplier Reward +R52
Add to Cart
Brand: FEIN Stock: 82
The FEIN MM 500 PLUS CE-Set stands apart from typical oscillating multi-tools by pairing a robust 350 W motor with the StarlockPlus tool holder, ensur..
Power Source... AC
R6,738
Ex Tax:R5,859
1 supplier Reward +R25
Add to Cart
Brand: FEIN Stock: 2
The FEIN AMM 700 1.7 Q AS is a cordless oscillating multi-tool engineered for demanding sawing, sanding, scraping, cutting, and polishing tasks. Its b..
Power Source... Battery
R6,984
Ex Tax:R6,073
1 supplier Reward +R26
Add to Cart
Brand: MAKITA Stock: 1
The Makita DTM52ZJX4 stands out with its brushless motor and Starlock Max tool holder, delivering efficient cutting and sanding without the hassle of ..
Power Source... Battery
R6,802
Ex Tax:R5,915
1 supplier Reward +R25
Add to Cart
Showing 51 to 82 of 82 (2 Pages)
Product Filter
WhatsApp
Hi, I’m DistriNode’s AI assistant. I can help you find products, compare options, create quote PDFs, or open support requests.